Protein Info for PFLU_RS15160 in Pseudomonas fluorescens SBW25-INTG

Annotation: beta-ketoacyl-ACP synthase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00109: ketoacyl-synt
  • amino acids 3 to 256 (254 residues), 203 bits, E=6.3e-64
• TIGR03150: beta-ketoacyl-acyl-carrier-protein synthase II
  • amino acids 3 to 419 (417 residues), 557.9 bits, E=5.7e-172
• PF02801: Ketoacyl-synt_C
  • amino acids 265 to 378 (114 residues), 125.4 bits, E=1.2e-40

Best Hits

Swiss-Prot: 56% identical to FABF_RHIME: 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09458, 3-oxoacyl-[acyl-carrier-protein] synthase II [EC: 2.3.1.179] (inferred from 100% identity to pfs:PFLU3108)

MetaCyc: 47% identical to (5Z)-3-oxo-dodec-5-enoyl-[acp] synthase (Enterococcus faecalis)
Beta-ketoacyl-acyl-carrier-protein synthase II. [EC: 2.3.1.179, 2.3.1.41]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• (5Z)-dodecenoate biosynthesis II (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.179, 2.3.1.41

Use Curated BLAST to search for 2.3.1.179 or 2.3.1.41

Sequence Analysis Tools

See C3KBB7 at UniProt or InterPro

Protein Sequence (422 amino acids)

>PFLU_RS15160 beta-ketoacyl-ACP synthase II (Pseudomonas fluorescens SBW25-INTG)
MSKRIVVTGMGALTPLGADVETTWRRLLAGQSGIRRLPQALIGDLAVSIGGQVQSVQQDP
EAGFDPDRLLAAKEQRKMDRFILFALAAADEALKQAGWTPETPEQQARTATIIASGVGGF
PAIADAVRTTDSKGPRRLSPFTIPSFLSNMAAGHVSINYGLKGPLGAPVTACAAGVQAIG
DAARMIRAGEVDVAVCGGAEAAIHRVSLAGFAAARALSSDFNDTPERASRPFDQARDGFV
MGEGAGILVIEALEHALARGAQPIAELVGYGTSADAYHMTAGPEDGDGAQRAMVQALRQA
GINADQVQYLNAHATSTPVGDKGELAAIRTVFGTGGSLAISSTKSATGHLLGAAGGIEAI
FTVLALRDQVAPVTLNLENPDALADGLDLLRGQARPMPIEYALSNGFGFGGVNASVLFRR
WA