Protein Info for PFLU_RS14920 in Pseudomonas fluorescens SBW25-INTG

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 202 to 225 (24 residues), see Phobius details PF17200: sCache_2" amino acids 48 to 192 (145 residues), 68.1 bits, see alignment E=1.7e-22 PF08269: dCache_2" amino acids 82 to 185 (104 residues), 49.4 bits, see alignment E=7.5e-17 PF00672: HAMP" amino acids 224 to 276 (53 residues), 50.3 bits, see alignment 5e-17 PF00015: MCPsignal" amino acids 376 to 522 (147 residues), 129.8 bits, see alignment E=2e-41

Best Hits

Swiss-Prot: 58% identical to MALCR_PSEAE: Methyl-accepting chemotaxis protein PA2652 (PA2652) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3059)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAE8 at UniProt or InterPro

Protein Sequence (557 amino acids)

>PFLU_RS14920 methyl-accepting chemotaxis protein (Pseudomonas fluorescens SBW25-INTG)
MSFKTKILLLTLLPVMLFALVLGLSARGTLQSQAEQEIAQTRERLLEESRTRLKDYASIA
RTSIAELYDRAAPGDSSSRVLAISRLSKVKYGDDGYFIGYDSQVVRLFRGESSEGVGINM
NDRKDVNGKYLNREMVEAAKNETHFVTYSGGVVNTDKVVPKLAYSFFLPKWDMVVITAIN
LDSIELQVAKVRSDVDRRVRNLMFSIALIATALIGIIGALSLVLVKRSLRPLTLIRAHLD
EIAAGEGDLTRRLPLVSRDELGQLAGSFNAFIEKIHSLVSQTVAMSEQLNGSVSRVADQS
RQIDRAMDKQRQETDLVAAAINQMSAAAQEVSVSAQNAAEAAAETDKQSRHARQIVDGSI
TRIQALTVELDASGISMKHLQSDVTSIVSVLDVIRSIAEQTNLLALNAAIEAARAGAAGR
GFAVVADEVRALASRTQRSTEEIQAMVERLKSATGGVVNAMHQSTEAAQGANAQADQAGE
FLGNTVELIATINAMNAQIASAAEEQTSVAEEINRGVHQIARAIDAVANQTQLGVKTIDE
MDMIGNRLRSLLGQFKI