Protein Info for PFLU_RS14805 in Pseudomonas fluorescens SBW25-INTG

Annotation: 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 48 to 69 (22 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 51 to 116 (66 residues), 23.8 bits, see alignment E=2.7e-09

Best Hits

Swiss-Prot: 77% identical to ARNF_PSEF5: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K12963, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF (inferred from 100% identity to pfs:PFLU3037)

Predicted SEED Role

"Polymyxin resistance protein PmrM" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAC8 at UniProt or InterPro

Protein Sequence (137 amino acids)

>PFLU_RS14805 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (Pseudomonas fluorescens SBW25-INTG)
MSRVQGFALALGSVGLVSAAQLGMRWSMTRLPLPSDWLDAFTHNSIDLGALGMVILAILA
YALSMLCWLGALKHLPLGRAYSLLSISYALVYLLAASLPVFNEDFSVSKTLGVALVILGV
LVINSRRASATSPRNAP