Protein Info for PFLU_RS14720 in Pseudomonas fluorescens SBW25-INTG

Annotation: chemotaxis protein CheB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF01339: CheB_methylest" amino acids 17 to 192 (176 residues), 189.8 bits, see alignment E=1.8e-60

Best Hits

Swiss-Prot: 44% identical to CHEB2_LEPIC: Putative protein-glutamate methylesterase/protein-glutamine glutaminase (cheB2) from Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to pfs:PFLU3019)

Predicted SEED Role

"Protein-glutamate methylesterase (EC 3.1.1.61)" (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAB0 at UniProt or InterPro

Protein Sequence (201 amino acids)

>PFLU_RS14720 chemotaxis protein CheB (Pseudomonas fluorescens SBW25-INTG)
MNQAAASPAKVRGIEAIVIGASAGGVEALLIVFGQLPADFGLPIVAVLHLPDERRSQLAE
VFDRRVAIPVVEARDKETLKPGTLYFAGPGYHLSVEQDRSLSLSQEDRVHHSRPAIDFLF
ESAAEAYGKGLMAILLTGANHDGARGLAYVKRQGGTTVVQDPTEARVDVMPRAALALHTP
DHILTLSRIGSLLASLEYSPC