Protein Info for PFLU_RS14670 in Pseudomonas fluorescens SBW25-INTG

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF13302: Acetyltransf_3" amino acids 8 to 142 (135 residues), 55 bits, see alignment E=3.8e-18 PF13420: Acetyltransf_4" amino acids 13 to 160 (148 residues), 32.8 bits, see alignment E=1.7e-11 PF13673: Acetyltransf_10" amino acids 39 to 145 (107 residues), 41 bits, see alignment E=4.5e-14 PF00583: Acetyltransf_1" amino acids 45 to 141 (97 residues), 68.3 bits, see alignment E=1.8e-22 PF13508: Acetyltransf_7" amino acids 59 to 143 (85 residues), 49.9 bits, see alignment E=8.6e-17

Best Hits

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to pfs:PFLU3009)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAA0 at UniProt or InterPro

Protein Sequence (170 amino acids)

>PFLU_RS14670 GNAT family N-acetyltransferase (Pseudomonas fluorescens SBW25-INTG)
MHTPEPHIVIQRFTEAHLEGVAALYNEPAVCRQVLQMPFQSVEAWRKRLVMDNERRLQLV
AVHGGEVIGQLGLEQYLRVRQAHVGSFGMGVATAWQGKGVGSRLLTAALDVADNWMNLHR
VELTVYADNEAAQALYRKFGFEVEGVLRDYALRDGRFVDTVSMARLRTSA