Protein Info for PFLU_RS14475 in Pseudomonas fluorescens SBW25-INTG

Annotation: molybdenum ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 3 to 357 (355 residues), 458.8 bits, see alignment E=6.9e-142 PF00005: ABC_tran" amino acids 16 to 161 (146 residues), 109.2 bits, see alignment E=2.7e-35 PF03459: TOBE" amino acids 295 to 358 (64 residues), 56.3 bits, see alignment E=3e-19

Best Hits

Swiss-Prot: 85% identical to MODC_PSEF5: Molybdenum import ATP-binding protein ModC (modC) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 100% identity to pfs:PFLU2969)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KB59 at UniProt or InterPro

Protein Sequence (359 amino acids)

>PFLU_RS14475 molybdenum ABC transporter ATP-binding protein (Pseudomonas fluorescens SBW25-INTG)
MIDVRLHLQYSGFALDVDLHLPGRGVTALYGHSGSGKTTCLRCIAGLERAEDGFIQINDE
VWQDSHNGRFVPPHKRALGYVFQEASLFAHLSVRDNLAFGLKRIPRQQRRVDMAQATELL
GIGHLLDRHPQHLSGGERQRIGIARALLTSPSLLLMDEPLAALDSQRKGEILPYLERLHD
ELDIPVLYVSHAQDEVARLADHIVLLSDGKALASGPIGETLARLDLPLALGDDAGVVING
TVNAYDDHYQLLTLQLPASALHMRVAHAPLAVGKALRIKVQARDVSLSLQAEEHSSILNR
LPVTVIQEISADNSAHVLVRLDAGGTPLLARITRFSRDQLQLHPGQTLWAQIKAVAVLA