Protein Info for PFLU_RS14310 in Pseudomonas fluorescens SBW25-INTG

Annotation: SgcJ/EcaC family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02246: conserved hypothetical protein" amino acids 40 to 163 (124 residues), 72.6 bits, see alignment E=1.5e-24 PF08332: CaMKII_AD" amino acids 41 to 163 (123 residues), 110.9 bits, see alignment E=1.3e-35 PF14534: DUF4440" amino acids 44 to 154 (111 residues), 48 bits, see alignment E=3.7e-16 PF13474: SnoaL_3" amino acids 46 to 162 (117 residues), 42.8 bits, see alignment E=1.6e-14 PF12680: SnoaL_2" amino acids 49 to 152 (104 residues), 35.5 bits, see alignment E=3.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2940)

Predicted SEED Role

"FIG00959942: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KB28 at UniProt or InterPro

Protein Sequence (172 amino acids)

>PFLU_RS14310 SgcJ/EcaC family oxidoreductase (Pseudomonas fluorescens SBW25-INTG)
MNVKAVSIAVIFALSAPFVQAAQTAPYVYRDVAQAPANAQDREIAGLFDRWNSALQTGNV
KSVVDLYAPGAVLQPTVSNQVRTTPEQITDYFDHFMTLKPVGQINYREIRQLGSNVAMDS
GVYTFTLTEKNGKVRHVQARYTFVYEQVGGQWKILNHHSSAMPEVQAKHAKQ