Protein Info for PFLU_RS14250 in Pseudomonas fluorescens SBW25-INTG

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 13 to 40 (28 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details PF12832: MFS_1_like" amino acids 11 to 332 (322 residues), 30.5 bits, see alignment E=2.1e-11 PF07690: MFS_1" amino acids 14 to 344 (331 residues), 84.5 bits, see alignment E=7.1e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2924)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KB12 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PFLU_RS14250 MFS transporter (Pseudomonas fluorescens SBW25-INTG)
MNLDVQRSLFVLYLLQLGITQGEIGILQSFLFFSSVALEIPSGLLADRYGRKLSLIISFL
GLFISGIGFLLFSSFTPFAIIFCLFGASIAMGSGSDRALLYDNLLAERRAEDYPKIISRA
RAIGAISLGLSMLLGGVLQDTFDWNSVYIFFALSKLIGAFAVTLIPEIKLPHTSLNPIKQ
SGINNKKTEGIFTLLINFFRSKKGAFLIPLFIGYSLFELSTIPLFIYGQPFFSLQGLDVP
MIAGIYATVEAISALMFMVAGYVCSRLSLGTIALTTTCAVTFLLFVLSLNIGVITSIATF
LLIMSLPAIYETAYETYIHDNIESRIRASCLSVANLVNSVIIGISYTVFGGLLDRYGFSL
TLIIVAATCFVGLFGVSTTLLLGGKKNDLTRQEA