Protein Info for PFLU_RS14235 in Pseudomonas fluorescens SBW25-INTG

Annotation: iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 118 to 142 (25 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details PF03239: FTR1" amino acids 1 to 265 (265 residues), 219 bits, see alignment E=4.3e-69

Best Hits

Swiss-Prot: 61% identical to EFEU_YERPA: Ferrous iron permease EfeU (efeU) from Yersinia pestis bv. Antiqua (strain Antiqua)

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 100% identity to pfs:PFLU2921)

Predicted SEED Role

"Ferrous iron transport permease EfeU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KB09 at UniProt or InterPro

Protein Sequence (281 amino acids)

>PFLU_RS14235 iron transporter (Pseudomonas fluorescens SBW25-INTG)
MLVPFLIMLREGIEAALIVGIIASYLQQTGRGQWMPAVWIGVFLAAALALLVGGGLELVS
AEFPQKQQELFEGIVGLVAVGILSSMVFWMRKVARSIKHSLHESLDHALAGSKHQVTALI
LMVFFAVAREGLETVFFLLAVFQQSEGPGAPIGALLGLILAIIVGFLIYTGSMRLNLGAF
FRWTGLFILVVAAGILANSVQALHEAGVWNHLQTVLFDFSAALPMDSPLGSVLAGMFGYQ
EAPTISTLGAYLIYLVVALVMFFLPAAPSKPAAAPSSVSSQ