Protein Info for PFLU_RS13495 in Pseudomonas fluorescens SBW25-INTG

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 726 PF13185: GAF_2" amino acids 171 to 312 (142 residues), 34.7 bits, see alignment E=5.1e-12 PF01590: GAF" amino acids 173 to 307 (135 residues), 51.1 bits, see alignment E=5.2e-17 PF00512: HisKA" amino acids 363 to 425 (63 residues), 33.9 bits, see alignment E=6.8e-12 PF02518: HATPase_c" amino acids 469 to 587 (119 residues), 61.3 bits, see alignment E=2.9e-20 PF00072: Response_reg" amino acids 613 to 720 (108 residues), 57.5 bits, see alignment E=3.6e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2765)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAX2 at UniProt or InterPro

Protein Sequence (726 amino acids)

>PFLU_RS13495 response regulator (Pseudomonas fluorescens SBW25-INTG)
MMNWLQSSSDMAERVRLHDWASTPLGPLEEWPDVLKTTAALCFASSFPQAIIWGPSLITL
YNDAFIPILGNKPDALGRPFSETWREVWEQVRPIADAAFDGHATFIENFPLMIERGDGPE
QAYFTFCYSPIRDPQGQVVGMLDTVTETTTTVFLNRRLAVLDAVGSAVANATDAESIMST
TTRLLAEHLQVSNCAYADMDADEDGFTIRGNWAAPGSPSILGHYSLASFGALAVQRLRAG
EPLVVQDNRFEFAPEVAASYQALGALATVCFPLIKDGRLTALMAVHHKTARAWSPYDLAL
VGEVTERSWAHIERVRADVAVREGLAAFTELNATLEQRVQERTNALTQAEAALRQSQKLE
AIGQLTGGVAHDFNNLLTIIRSSVDFLRQPGLSEERRQRYMGAVSDTVERASKLTSQLLA
FARRQPLNPEVFDAGQRVKNIGEMLESVTGARIHVQVQLPERPCHVRVDASQFETALINI
ALNARDAMDGQGTLTLRVANVDSMPRIRGDEEAHQPFVSISLADTGTGISSDTFERIFEP
FFTTKAVGKGTGLGLSQVFGFAKQSGGNVDVASRPGEGTVFTLYLPEVAQQVEQPDPTPE
SQSPTHDTAQCHILIVEDNLEVGRFANQILQDLGYQTTWATDAEQALTLAGADALAFDGI
FSDVVMPGMTGVAMAKVLRQRRPDLPVVLTSGYSEELADSGYEGFEFLAKPYSADQVARA
LAKAML