Protein Info for PFLU_RS13355 in Pseudomonas fluorescens SBW25-INTG

Annotation: threonine ammonia-lyase, biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01124: threonine ammonia-lyase, biosynthetic
  • amino acids 18 to 334 (317 residues), 486.1 bits, E=5.9e-150
• PF00291: PALP
  • amino acids 32 to 319 (288 residues), 287.8 bits, E=4.9e-90

Best Hits

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 80% identity to pfl:PFL_3098)

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-methionine degradation II (3/3 steps found)
• L-threonine degradation I (4/6 steps found)
• L-threonine degradation V (1/2 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Protein Sequence (340 amino acids)

>PFLU_RS13355 threonine ammonia-lyase, biosynthetic (Pseudomonas fluorescens SBW25-INTG)
MSTCTAPHTADPGLLEHYVKKILAAPVYDLAVRTPLQAAPALSALLGNQVLLKREDLQPT
FSFKIRGAYNKLVQLTPEQKARGVVTASAGNHAQGVALAARELGIKARIVMPSSTPELKV
LGVRSRGAEAVLHGASFPFALAHALQLAEQSGGTFVSPFDDPEVIAGQGTVAMEILRQQQ
GPLDAIFVPVGGGGLIAGVAAYVKYLRPEVRIIGVEPEGSSCLLAALRAGERVVLPSVDG
FADGTAVAQVGAYGFEICRDLVDEVITVSNDQLCSAIKLIYDDTRSITEPSGALAVAGLR
EYVTSHNLRGQTLVAINSGANINFDSLRYVAERVAAQGAV