Protein Info for PFLU_RS13295 in Pseudomonas fluorescens SBW25-INTG

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details PF00672: HAMP" amino acids 159 to 207 (49 residues), 23.5 bits, see alignment 8.5e-09 PF00512: HisKA" amino acids 212 to 276 (65 residues), 41.4 bits, see alignment E=1.8e-14 PF02518: HATPase_c" amino acids 324 to 431 (108 residues), 80.6 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to pfs:PFLU2723)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAT2 at UniProt or InterPro

Protein Sequence (433 amino acids)

>PFLU_RS13295 HAMP domain-containing protein (Pseudomonas fluorescens SBW25-INTG)
MFRVLLRLYLITIVTYSLAIYLIPSLVIQLFEHRYMNYNIEQTRGQQKLIVKQYLRAPVE
RWSQVTEQLGHDFAPLKVQLLLRQDASYSPAQEKLLEQGKSVVRLGEWGWMEEISSPINE
QFVVKLTIPPDPMDMNVLYWAINVLIVAALLACLLVWLRPHWRDLERLKSTAGQLGQGNL
AERTRIPASSSIGSLASVFDTMADDIEHLLNQQRDLLNAVSHELRTPLTRLDFGLALALS
EDLPEASRERLQSLVAHIRELDELVLELLSYSRLQNPAQLPERVEVVLDEFIDSVLGSVD
DELENPEIVIDVALDCAVERFSLDPRLTARALQNLLRNATRYCDKRIQVGVKVCPKGCEI
WVDDDGIGIPLDQRERIFEPFYRLDRSRDRATGGFGLGLAISRRALEAQGGTLTALASPL
GGARFRVWLPSVA