Protein Info for PFLU_RS13015 in Pseudomonas fluorescens SBW25-INTG

Annotation: precorrin-4 C(11)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00590: TP_methylase" amino acids 2 to 206 (205 residues), 172.3 bits, see alignment E=7e-55 TIGR01465: precorrin-4 C11-methyltransferase" amino acids 3 to 247 (245 residues), 316.3 bits, see alignment E=6.2e-99

Best Hits

Swiss-Prot: 74% identical to COBM_PSEAE: Precorrin-4 C(11)-methyltransferase (cobM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05936, precorrin-4 C11-methyltransferase [EC: 2.1.1.133] (inferred from 100% identity to pfs:PFLU2665)

Predicted SEED Role

"Cobalt-precorrin-4 C11-methyltransferase (EC 2.1.1.133)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K9S1 at UniProt or InterPro

Protein Sequence (248 amino acids)

>PFLU_RS13015 precorrin-4 C(11)-methyltransferase (Pseudomonas fluorescens SBW25-INTG)
MTVYFIGAGPGDPELITVKGQRLIRSCPVIIYAGSLVPAAVLEGHQAETVVNSAELHLEQ
IIDLIKTAHAKGQDVARVHSGDPSLYGAIGEQIRHLREWGIPFQIIPGVTAVAACAALLE
TELTLPDIAQSVILTRYADKTRMPAGEDFDSLARHGTTMAIHLGVNHLEKIVAELLPHYG
ADCPIAVVHRATWPDQDWAVGTLSDIAGKVAAKGFRRTALIVVGRVLASDSFSESSLYRA
GHAHLYRP