Protein Info for PFLU_RS12770 in Pseudomonas fluorescens SBW25-INTG

Annotation: protease SohB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 182 to 197 (16 residues), see Phobius details PF08496: Peptidase_S49_N" amino acids 2 to 149 (148 residues), 188.7 bits, see alignment E=6.5e-60 PF01343: Peptidase_S49" amino acids 153 to 301 (149 residues), 154 bits, see alignment E=3.2e-49

Best Hits

Swiss-Prot: 53% identical to SOHB_ECOLI: Probable protease SohB (sohB) from Escherichia coli (strain K12)

KEGG orthology group: K04774, serine protease SohB [EC: 3.4.21.-] (inferred from 100% identity to pfs:PFLU2614)

Predicted SEED Role

"Peptidase, U7 family"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K9M2 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PFLU_RS12770 protease SohB (Pseudomonas fluorescens SBW25-INTG)
MDFLAEYASFLAKTVTLVVAILVVLISFAALRSKGRRKSAGQLQVSKLNDFYKGLRERLE
SSLLDKDQLKALRKSEGKAEKKKGKHKADAKPRVFVLDFDGDIKASATESLRHEITALLS
LATPKDEVVLRLESGGGMVHSYGLASSQLARIRQAGVPLTVCIDKVAASGGYMMACIGEK
IISAPFAILGSIGVVAQLPNVNRLLKKHDIDFEVLTAGEYKRTLTVFGENTEKGREKFQE
DLDITHQLFKNFVSRYRPQLAIDDVATGEVWLGVAALDKQLVDELQTSDEYLATKAKTAE
VFHLHYAERKSLQERVGLAASGSVDRVLLTWWSRLTQQRFW