Protein Info for PFLU_RS12715 in Pseudomonas fluorescens SBW25-INTG

Annotation: fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 27 to 228 (202 residues), 197.3 bits, E=1.3e-62

Best Hits

Swiss-Prot: 41% identical to FAHD1_MOUSE: Acylpyruvase FAHD1, mitochondrial (Fahd1) from Mus musculus

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2602)

MetaCyc: 59% identical to 3-fumarylpyruvate hydrolase (Bradyrhizobium sp. JS329)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

• gentisate degradation I (2/3 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• 5-nitroanthranilate degradation (2/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.20

Sequence Analysis Tools

See C3K9L0 at UniProt or InterPro

Protein Sequence (231 amino acids)

>PFLU_RS12715 fumarylacetoacetate hydrolase family protein (Pseudomonas fluorescens SBW25-INTG)
MTDYVLTPTPTPSLAVQGSAARFPLRRVFCVGRNYSEHAREMGHDPDREPPFFFMKPADA
VVPAEGVIAYPPLTADLHHEVELVVAIGKDGVNISPEQAFSHIWGYGVGIDLTRRDLQAQ
AKKLSRPWEWAKAFDESAPSTALQPVSAVGHPSSGRIWLQVNGEQRQVGDLADQIWSVSE
VISHASNAVALKAGDLIFTGTPAGVGALQPGDVVTAGIDGIGELRFTLRQR