Protein Info for PFLU_RS12710 in Pseudomonas fluorescens SBW25-INTG

Annotation: AbrB family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 31 to 46 (16 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 258 to 285 (28 residues), see Phobius details amino acids 305 to 329 (25 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 8 to 161 (154 residues), 107.6 bits, see alignment E=2.7e-35 PF05145: AbrB" amino acids 31 to 335 (305 residues), 213 bits, see alignment E=2.7e-67

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2601)

Predicted SEED Role

"Ammonia monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K9K9 at UniProt or InterPro

Protein Sequence (350 amino acids)

>PFLU_RS12710 AbrB family transcriptional regulator (Pseudomonas fluorescens SBW25-INTG)
MPNFRAYWLVTLIVGALGGSLASWAGWPLPWVIGSLVAVMLTRCAGGRVPEIPHGRHVGQ
LIVAVAIGCHFTLPVMQQVAAHLGLIVTAVLLTLVLALCSVLILHRWGVPFGTAFFALMP
ANSSEMVHLGRQRQADTAFIAAAHSIRLLLILLTVPAVATFGLPAVAAPAPLPVIWPWLI
FILAMGWLAALGFKQCKLPNPWTFGPFLICAVGVGCNNLSMSIPGWLSGSGQLLIGCALG
VAFDRSFFRRAPGLLAKVLLLLTASVITTALAAWALGAGLGMPWLSLALGMMPGSAPEMS
LTAEALGLAVTLVTAMQVIRMLLIQAACLPLYRLLNPEKQAQAPVSAKSA