Protein Info for PFLU_RS12500 in Pseudomonas fluorescens SBW25-INTG

Annotation: MacB family efflux pump subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 transmembrane" amino acids 251 to 270 (20 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 525 to 551 (27 residues), see Phobius details amino acids 576 to 605 (30 residues), see Phobius details amino acids 611 to 635 (25 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 111.5 bits, see alignment E=1e-35 PF12704: MacB_PCD" amino acids 276 to 495 (220 residues), 154.4 bits, see alignment E=1e-48 PF02687: FtsX" amino acids 531 to 645 (115 residues), 74 bits, see alignment E=2e-24

Best Hits

Swiss-Prot: 85% identical to MACB1_PSEF5: Macrolide export ATP-binding/permease protein MacB 1 (macB1) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 100% identity to pfs:PFLU2556)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K9G5 at UniProt or InterPro

Protein Sequence (652 amino acids)

>PFLU_RS12500 MacB family efflux pump subunit (Pseudomonas fluorescens SBW25-INTG)
MTQPLLELKGITRSFMAGEREFIALKGIDLTIHAGEMVAIIGASGSGKSTLMNILGGLDY
ATAGSYKINGIETRSLGDEQLAELRRDYFGFIFQRYHLLAHLSALHNVEMPAIYAGTPET
ARHSRARELLTRLGLAGHTTHRPSQLSGGQQQRVSIARALMNGGEVILADEPTGALDTHS
GKEVMRILAELHAAGHTVIIVTHDPKVAANAQRIVEVSDGEIVSDKANDGVGLELPSDTP
IEPRRSGARRLVASLGLFKEAFNMAWVALVSHRMRTLLTMLGIVIGITSVVSISAIGEGA
KRYVLKDIQAIGSNTIDIFSGTSFGDSRASAIETLMPSDVDALNQLYYVDSATPVVGRNL
LLRFGNIDLDAQVNGVSDRYFKVKGLKLEAGIAFSESDARRQAQVVVIDHNTRHRLFGPN
VDPLGQVILVGNLPCTVIGVTADNKNMFAASKALNVWVPYETAAGRLLGQRHLDSITVRI
KDGQPSKVVEDNVNKLMLQRHGTKDFFTNNLDSIMQTVQKTSRSLALLLSLIAVISLLVG
GIGVMNIMLVSVTERTREIGIRMAVGARQSDIRQQFLVEAVMVCLIGGLIGISLSYALGF
LFSLFVKEWEMVFSLGSIITAFACSTLIGIVFGFVPARNAARLDPIEALARD