Protein Info for PFLU_RS12445 in Pseudomonas fluorescens SBW25-INTG

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 811 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details PF07660: STN" amino acids 66 to 115 (50 residues), 32.2 bits, see alignment 1.1e-11 PF07715: Plug" amino acids 159 to 261 (103 residues), 75.3 bits, see alignment E=8.1e-25 TIGR01783: TonB-dependent siderophore receptor" amino acids 161 to 811 (651 residues), 348.9 bits, see alignment E=3.4e-108 PF00593: TonB_dep_Rec" amino acids 340 to 780 (441 residues), 152 bits, see alignment E=7.7e-48

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to pfs:PFLU2545)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K9F5 at UniProt or InterPro

Protein Sequence (811 amino acids)

>PFLU_RS12445 TonB-dependent siderophore receptor (Pseudomonas fluorescens SBW25-INTG)
MSARLGLSPLSKALTRALNINLLPSALALAVSLPVAGYVQAQEIELDIPAQALGSALQEF
GRQANLQVLYSPTDVAGKNSTAIKGKLDPQQAINTLLAGTSTTHSLSGNALTVTAAGASA
GLELSPTQVTGNVLGNITEGSGSYTPGTIATATRLTLTPRETPQSITVITRQHIEDFGLN
NVDDVMRHTPGITVSAYDTDRTNYYSRGFSVNSFQYDGIPSTVRNVGYSAGNTLSDMAIY
DRVEVLKGATGLLNGAGSLGATINLIRKKPTSEFKGHVQLGAGSWDNYRSEVDVSGPLTD
SGNVRGRAVAAYQDKKSFMDHYSRKTETYYGITEFDLSPDTMLTVGFDYQDNIPKGSSWS
GSFPLVNSNGSINKMPRSYNNGATWSSWEQNTRTAFAMLEHDMGDGWVTKFQLDHKINSY
HADLGSIQFVQPAADGTAEVNGQKYTGETKSTSADLYATGPFSLFGREHELVVGGSIGTS
RWQGKGYWSPEWPGGNKVDFYNWNGHIAKPIYGPVQQYIDDTIRQTGYYMTTRLNVMDDL
HVILGGRVANYHVTGINPSYKETGRFVPYAGVVYDLNDNISAYASYTDIFQPQESTYKDR
NQKLLEPDEGQNYELGLKGDFLDGRLNASLAYFEVHETNRAISDDAYNNQTPAPNNYAFK
GSKAVTKGYEAEVSGELAPGWQVQGGYTHKIVRDDDDKKISTFEPEHQVNLNTTYKLKGD
LDQFTIGGGLRWQSKGWYEIYNSPLNTNQDITQKSYWLVDLMTRYQVTKNLSATVNFNNI
FDKSYYTNVGFYNSAAYGEPRNVMFSTRWDF