Protein Info for PFLU_RS11565 in Pseudomonas fluorescens SBW25-INTG

Annotation: GntP family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 29 to 50 (22 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details amino acids 400 to 418 (19 residues), see Phobius details amino acids 424 to 449 (26 residues), see Phobius details amino acids 461 to 484 (24 residues), see Phobius details PF02447: GntP_permease" amino acids 7 to 224 (218 residues), 225.3 bits, see alignment E=1.3e-70 amino acids 261 to 482 (222 residues), 208.1 bits, see alignment E=2.1e-65 PF03600: CitMHS" amino acids 30 to 426 (397 residues), 49 bits, see alignment E=4.9e-17

Best Hits

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 100% identity to pfs:PFLU2355)

Predicted SEED Role

"Gluconate permease" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K8J4 at UniProt or InterPro

Protein Sequence (486 amino acids)

>PFLU_RS11565 GntP family transporter (Pseudomonas fluorescens SBW25-INTG)
MSPLILMLTAGAGIALLLFLVLKYKFQPFVALMLVSIVVALVAGVKPADLVATIEGGMGK
TLGHIAIIIALGAMIGRIIELSGGAEALAKSLIERFGNSRTPLALTIAGFIIGVPVFFEV
GVIILMPLAYGVARRARKPLLMFALPMCAALLTVHAFLPPHPGAVAAASQLGADLGRVLM
FGLPITALLCYVGYRVAGRMTRRFYPMTDDIRAEVYGPHVTNEDLRAWTNGNHQAVQPSA
VAESPMGLEESTSAIAAKLPAAPAPGFGLIVGLILLPIVLILLGTLATSLLPIESTLRGV
MTVLGAPLVALLIDTLLCAWLLGSRRGWSRSQVSDVIGSALPGVAMVILIAGAGGVFGKV
LVDTGIGAVVSDMLRTTGLPVLALGFLLTMLLRAVQGSTTVALVTTAGIISPLIATLNLT
PNHLALLCLAMGGGGLAMSHINDAGYWIFTKLAGLNVADGLRTWTVITTLLGTLGFVITL
LIWPFV