Protein Info for PFLU_RS11505 in Pseudomonas fluorescens SBW25-INTG

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01547: SBP_bac_1" amino acids 38 to 281 (244 residues), 64.7 bits, see alignment E=1.5e-21 PF13416: SBP_bac_8" amino acids 45 to 298 (254 residues), 149.3 bits, see alignment E=1.9e-47

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to pfs:PFLU2343)

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein potD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K8I2 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PFLU_RS11505 ABC transporter substrate-binding protein (Pseudomonas fluorescens SBW25-INTG)
MVLNKRATAVLFAGLLATATHAALAAESVNFVSWGGSTQDAQKQAWADPFSKASGITVVQ
DGPTDYGKLKAMVESGNVQWDVVDVEADFALRAAAEGLLEPLDFSVIQRDKIDPRFVSDH
GVGSFFFSFVLGYNEGKLGAGKPQDWTALFDTKTYPGKRALYKWPSPGVLELALLADGVP
ADKLYPLDLDRAFKKLDTIKKDIVWWGGGAQSQQLLASGEVSMGQFWNGRIHALQEDGAP
VGVSWKQNLVMADILVVPKGSKNKAAAMKFLANASSAKGQADFSNLTAYAPVNIDSVQRL
DSVLAPNLPTAYVKDQITLDFAYWAKNGPAIATRWNEWLVK