Protein Info for PFLU_RS11415 in Pseudomonas fluorescens SBW25-INTG

Annotation: protein glxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01493: GXGXG
  • amino acids 12 to 186 (175 residues), 44.7 bits, E=5.7e-16

Best Hits

Swiss-Prot: 60% identical to GLXC_RHIME: Protein GlxC (glxC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2325)

MetaCyc: 59% identical to N-methyl-L-glutamate synthase beta subunit (Methyloversatilis universalis)
Methylamine--glutamate N-methyltransferase. [EC: 2.1.1.21]

Predicted SEED Role

"Glutamate synthase [NADPH] putative GlxC chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-citrulline biosynthesis (8/8 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• methylamine degradation II (3/3 steps found)
• superpathway of trimethylamine degradation (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Methane metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13 or 2.1.1.21

Sequence Analysis Tools

See C3K8G4 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PFLU_RS11415 protein glxC (Pseudomonas fluorescens SBW25-INTG)
MKTIDLSTATVRDLNQALHAQAIDNEWRVTHSNGKHNLAVGVNQAVSIDIEGHAGYYCAG
MNQQASITVHGNVGVGCAENMMSGSVRVKGSASQAAGATAHGGLLVIEGDAGARCGISMK
GIDIVVGGSIGHMSCFMGQAGRLVVCGDAGDALGDSLYETHIYVKGTVESLGSDCVEKEM
RSEHLHELQELLDRAGFAHQAADFKRYGSARQLYNFKVDNASAY