Protein Info for PFLU_RS10665 in Pseudomonas fluorescens SBW25-INTG

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF08448: PAS_4" amino acids 22 to 136 (115 residues), 23.7 bits, see alignment E=1.5e-08 TIGR00229: PAS domain S-box protein" amino acids 140 to 261 (122 residues), 38.5 bits, see alignment E=5.8e-14 amino acids 263 to 387 (125 residues), 47.8 bits, see alignment E=7.5e-17 PF13426: PAS_9" amino acids 157 to 208 (52 residues), 27.5 bits, see alignment 9.4e-10 amino acids 280 to 379 (100 residues), 32.6 bits, see alignment E=2.4e-11 PF00989: PAS" amino acids 276 to 365 (90 residues), 26.3 bits, see alignment E=1.9e-09 PF00196: GerE" amino acids 428 to 482 (55 residues), 60.3 bits, see alignment 3.3e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2169)

Predicted SEED Role

"Sensory box transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K7A1 at UniProt or InterPro

Protein Sequence (496 amino acids)

>PFLU_RS10665 helix-turn-helix transcriptional regulator (Pseudomonas fluorescens SBW25-INTG)
MTQDVLAKETNRRQLQQIISGVSDGIILAEVDQTILWANEAALNMHGIDDVTALGANTQA
YAEHFALRYRNNHPVLLENYPLARVAAGEEFSDVVVECTPIADADKTWVHRLRSLIITDS
HGEPELLVLILSDATEWASAEQRFEKTFNANPAPAVICRLSDLRYIKVNQGFLEMTGYNR
DQVIGKSVYELDVLEQAERKDLAIQRLGEGATIPQMQAELRLPEGGSKLVIVAGQPLDMN
EEDCMLFSFMDLEPRRKAEIALRQSEERFAKSFRLTPVPTLVCSAANRQVVDINEAFMSL
TGYTSEELIGKSVEDIDFIDSPQAGAQLFTSLEKAGNLDGQDLKVRKKGNEVIDCVVSAD
TVIIQDVPCYLLVMMNITERKRSELELVAAIEEVMQDASWFSQTLIEKLANAKSVNSPNQ
PNISFTDLTARERDVLGLICEGLADKEIALRLKLAPNTVRNHVATVYSKLGVHSRSAAIV
WARERGLFAGELRLKK