Protein Info for PFLU_RS10270 in Pseudomonas fluorescens SBW25-INTG

Annotation: DJ-1/PfpI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 5 to 164 (160 residues), 105.9 bits, E=1e-34

Best Hits

Swiss-Prot: 75% identical to INHA_PSEPU: Isonitrile hydratase (inhA) from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2085)

MetaCyc: 75% identical to isocyanide hydratase subunit (Pseudomonas putida N19-2)
Cyclohexyl-isocyanide hydratase. [EC: 4.2.1.103]

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Caprolactam degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.103

Sequence Analysis Tools

See C3K5Q3 at UniProt or InterPro

Protein Sequence (226 amino acids)

>PFLU_RS10270 DJ-1/PfpI family protein (Pseudomonas fluorescens SBW25-INTG)
MTLQIGFLLFPGIQQLDLTGPYDVLGSLPDVKLHLVWKDLEPVTSSTGLVFTPTMTYAEC
PRLDVICVPGGSGVGALMEDPQTLDFLKAQAQTARYVTSVCTGSLVLGAAGLLRGRQATT
HWAYHDMLAPLGAIPVQARVVRDGNLLTGGGITAGIDFALSLAAELYSEAAAQLVQLQIE
YAPAPPFNSGRPDTAPQHVLEEANKRTTESRRVRGEIVARAAARLG