Protein Info for PFLU_RS10220 in Pseudomonas fluorescens SBW25-INTG

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF13579: Glyco_trans_4_4" amino acids 16 to 180 (165 residues), 31.1 bits, see alignment E=7.2e-11 PF13439: Glyco_transf_4" amino acids 17 to 183 (167 residues), 39.1 bits, see alignment E=2e-13 PF00534: Glycos_transf_1" amino acids 199 to 305 (107 residues), 49.7 bits, see alignment E=7.8e-17 PF13692: Glyco_trans_1_4" amino acids 203 to 308 (106 residues), 45.2 bits, see alignment E=3e-15 PF20706: GT4-conflict" amino acids 210 to 354 (145 residues), 31.2 bits, see alignment E=2.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2074)

Predicted SEED Role

"Glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K540 at UniProt or InterPro

Protein Sequence (367 amino acids)

>PFLU_RS10220 glycosyltransferase family 4 protein (Pseudomonas fluorescens SBW25-INTG)
MRVGLDYRTVGTSPQSGISRQVYALESALHSLPGIELERFTVAPLGDETRLQAHCPAWGC
AKTAMHQPQNRLRFEAGFLPRALREQHIDLYISTFNMGLPLPPKPKGLRTVVLLHDLFQI
TLNNYHANRLKALIYKTSDRLSIAYAVHSADRVWTPSQYSADETARLFPKAAGKIRVLPN
QVDGFSALAADLSARQLPERYWLLVGTRELRKNVPFLVEAWQQARRQSPAVPELVLVGSL
DHLPEAQRALPGIRALSGVSDAELHALYRRASRLWQPSYAEGFGLPVIEALSVGTPVAVA
SGTSLDEITPPSAPRFSPTDGPALTQLMVSLSEQADEASPEQHRQWAERFNHHAYQRRLA
ELIKELT