Protein Info for PFLU_RS10190 in Pseudomonas fluorescens SBW25-INTG

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 12 to 149 (138 residues), 65.7 bits, E=7.2e-22
• PF00583: Acetyltransf_1
  • amino acids 66 to 148 (83 residues), 27.1 bits, E=4.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2068)

Predicted SEED Role

"Amino-acid acetyltransferase (EC 2.3.1.1)" (EC 2.3.1.1)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

See C3K534 at UniProt or InterPro

Protein Sequence (192 amino acids)

>PFLU_RS10190 GNAT family N-acetyltransferase (Pseudomonas fluorescens SBW25-INTG)
MTQITLTGTTVELLPLQRAHKAALLEAAADGELWNLKVTHVPGPDTVDQYIDTALAGRDA
GTMIPFTLVRRDTGHVVGSTRFWKVDRVNRKLEIGHTWLALSAQKSGINTEAKLLLLTYA
FDVLDCVRVQFTTDELNEKSRAAILRLGAVQEGIVRHERIMPDGRKRNSVRFSIIDSEWP
QVKANVQAKLQR