Protein Info for PFLU_RS09930 in Pseudomonas fluorescens SBW25-INTG

Annotation: BCCT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details amino acids 449 to 468 (20 residues), see Phobius details amino acids 479 to 497 (19 residues), see Phobius details PF02028: BCCT" amino acids 9 to 498 (490 residues), 402 bits, see alignment E=1.7e-124

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2021)

Predicted SEED Role

"Glycine betaine transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K8A4 at UniProt or InterPro

Protein Sequence (527 amino acids)

>PFLU_RS09930 BCCT family transporter (Pseudomonas fluorescens SBW25-INTG)
MKYPLRPLVFWPTFLILLAAVIASYVDLNAFLAVSKQLNNLILKNFSWLFSAGSFAMVVL
TAIVYFSALGKVRIGGEDAQPLLSKWRWFMVALCTTLAVGVLFWTTAEPLYHLYGPPTSL
PIEAGSSAAKSFAMSTMFLHWTITPYAIYLVPSLVFALVFYNRRSNFSIGAMLEPLLGAA
RVKRYAGLIDTLAMFALVAGMASSLGTGALTLAGGMAQYIGGETTPLRLAIIITIIVITF
VASAASGLQRGIVMLSSFNTWIMLALGLFVLLCGPTLYMFSLGVESLGVYLDTFFSRSLF
TGAASGDTWPHSWTVFYWSVWFAWAPVSALFLGKIGRGYTVREFIHINMLYPALFTAVWI
CIFSGTSLYFDALGDGSLNRVLNEQGVEHVLYQMFQQLPASGLMIAFLLFVAFISFVTAA
DSSTDVIANLCSKGVTADSDLDGNPLLKIIWGLIIGSVSWVMVAFVGVDGVKMLSNLGGL
PGMILVLLASTSLIFWLKNPALLDVKNLRPTTEPELRGASPVAAFAR