Protein Info for PFLU_RS09865 in Pseudomonas fluorescens SBW25-INTG

Annotation: allantoin permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2000)

Predicted SEED Role

"Cytosine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K7R4 at UniProt or InterPro

Protein Sequence (440 amino acids)

>PFLU_RS09865 allantoin permease (Pseudomonas fluorescens SBW25-INTG)
MAALSQSSQTGQDPANHPVPADARMGRLSLTMAWWAVCSAMFYIVVGASLALSYGARNAL
IGMVLSVISYGLVNSVLSRFAIRSGLSVALFSRLLFGSTGACLATLIFFSTAIYYAVFEG
SVIAVALNHLYPQLVFPLAALLVVLYSVPMILGSVQHWLDKLNGVLLPVYLGGLLVAVGL
SISRYGYQPQWLDFGPATPSAFGWWDCFVAYMGIWVLMLFTFDYARFGKPKDAEYHGRWN
FGMPFYAVTFLLNGAAGIYLVSSIPHEGALNEVSVVMAILQLMGLWGLLFVWATQTRINT
ANYYLATMNMQAFFARFGIRGSYLMWALTVGVIVYGLMLADVFTYLLKALAYQGIFVVAW
VGVALAQILYGRSEVAALERVKAFNSAGLSAWFGATALGLALMFSGPGLSSFSAPSTVIV
AFALQAGLSHRSRLRLKSAE