Protein Info for PFLU_RS08760 in Pseudomonas fluorescens SBW25-INTG

Annotation: phosphonate C-P lyase system protein PhnG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 TIGR03293: phosphonate C-P lyase system protein PhnG" amino acids 5 to 144 (140 residues), 168.9 bits, see alignment E=3.2e-54 PF06754: PhnG" amino acids 5 to 143 (139 residues), 170.7 bits, see alignment E=9.3e-55

Best Hits

Swiss-Prot: 46% identical to PHNG_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG (phnG) from Escherichia coli (strain K12)

KEGG orthology group: K06166, PhnG protein (inferred from 100% identity to pfs:PFLU1781)

MetaCyc: 46% identical to carbon-phosphorus lyase core complex subunit PhnG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PhnG protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K5L6 at UniProt or InterPro

Protein Sequence (145 amino acids)

>PFLU_RS08760 phosphonate C-P lyase system protein PhnG (Pseudomonas fluorescens SBW25-INTG)
MSLSPRQHWIGVLARAQLSELQPHEAALKDAEYQLIRAPEIGMTLVRGRMGGNGAPFNVG
EMSVTRCVVRLADGRTGYSYLAGRDKVHAELAALADAHLQGTQPSRWLSDLITALANAQA
ARRAQKEADTAATKVEFFTLVRGEN