Protein Info for PFLU_RS08750 in Pseudomonas fluorescens SBW25-INTG

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 21 to 259 (239 residues), 311.8 bits, see alignment E=1.7e-97 PF00528: BPD_transp_1" amino acids 89 to 256 (168 residues), 77.1 bits, see alignment E=7.7e-26

Best Hits

Swiss-Prot: 71% identical to PHNE_ECOBD: Phosphonate transport system permease protein PhnE (phnE) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 100% identity to pfs:PFLU1779)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K5L4 at UniProt or InterPro

Protein Sequence (260 amino acids)

>PFLU_RS08750 phosphonate ABC transporter, permease protein PhnE (Pseudomonas fluorescens SBW25-INTG)
MTTLHAEAVGKRTWPQYLGWGLFLVLLAWAWHGAEMNPLALYRDSGNMATFAADFFPPDF
HEWRSYLKEMIVTVQIALWGTVLAIVCSVPLGILCADNITPWWVHQPLRRVMDAFRSINE
MVFAMLFVVAVGLGPFAGVLALWISTTGVLAKLFAEAVEAIDPGPVEGVRATGASALQEV
IYGVIPQVMPLWVSYALYRFEANVRSATVVGMVGAGGIGVILWENIRAFQFVQTCAVLLV
IIVVVSAIDVLSQRLRKQFI