Protein Info for PFLU_RS08745 in Pseudomonas fluorescens SBW25-INTG

Annotation: phosphonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03431: phosphonate ABC transporter, periplasmic phosphonate binding protein" amino acids 7 to 289 (283 residues), 317.6 bits, see alignment E=8.2e-99 TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 8 to 251 (244 residues), 259.4 bits, see alignment E=3.5e-81 PF12974: Phosphonate-bd" amino acids 32 to 277 (246 residues), 252.2 bits, see alignment E=5e-79

Best Hits

Swiss-Prot: 60% identical to PHND_ECOLI: Phosphonates-binding periplasmic protein (phnD) from Escherichia coli (strain K12)

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 100% identity to pfs:PFLU1778)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K5L3 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PFLU_RS08745 phosphonate ABC transporter substrate-binding protein (Pseudomonas fluorescens SBW25-INTG)
MLNRIGHVFLSAVLLASVALGNAHAADKVINFGIMSTESSQNLKSIWQPFLDDMHKKTGL
TINATFASDYAGLIQGMRFNKVDVAWLGNKAAMEAVDRSNGEIFAQTAAANGAAGYWSVL
IVRKDSPINNVDDMLKNAKNLTFGNGDPNSTSGYLVPGYYVFAKNNVDAATAFKRTLNSS
HEVNALSVAKGQLDVATFNTESWDRLEVTQPDKAAMLKVIWKSPLIPADPMVWSKALSDS
EKTKIRDFFANYGDTDEEKAVLKNMQLGKFLASNDDQLLPIRQLELFKQRTTISADSKLD
AADKAKKLADIDADLAKLQQRISELDKKTAVNG