Protein Info for PFLU_RS08725 in Pseudomonas fluorescens SBW25-INTG

Annotation: peptide chain release factor N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00536: methyltransferase, HemK family
  • amino acids 47 to 265 (219 residues), 138.4 bits, E=1.3e-44
• PF03602: Cons_hypoth95
  • amino acids 96 to 191 (96 residues), 40.5 bits, E=7.2e-14
• PF05175: MTS
  • amino acids 100 to 192 (93 residues), 47.5 bits, E=4.7e-16
• PF10294: Methyltransf_16
  • amino acids 103 to 159 (57 residues), 22.1 bits, E=3.3e-08
• PF13847: Methyltransf_31
  • amino acids 105 to 251 (147 residues), 29.5 bits, E=1.8e-10

Best Hits

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to pfs:PFLU1774)

Predicted SEED Role

"Para-amino-L-phenylalanine methyltransferase (EC 2.1.1.-)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See C3K502 at UniProt or InterPro

Protein Sequence (286 amino acids)

>PFLU_RS08725 peptide chain release factor N(5)-glutamine methyltransferase (Pseudomonas fluorescens SBW25-INTG)
MSLDKHEQEAIAKARVQLEAAGVWDPDNDLDSLVDRFIVRADKQRALDEFRLAVSERCNR
IPLGHIVGTVAFDELSLVVGSGVFIPRPHSTVIHKWLDETELATGTCVLDLCAGSGAIGL
AIARRRPDLDVTCVEREDVAVNYLKRNIARLATKNVQVSAAQADVYDTKAFARFRQQVGL
IVANPPYVPQKAQLQPEWGDHHPKAAVYSGTDGLDLTRQIITLATTLLTPDGWLVIEHGE
DQASAVRELFEQHQLTEIRTVIDRQASDTTGTSVMTVGCLSKAVHP