Protein Info for PFLU_RS08710 in Pseudomonas fluorescens SBW25-INTG

Annotation: aminodeoxychorismate synthase component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 3 to 185 (183 residues), 146.3 bits, see alignment E=9.1e-47 PF00117: GATase" amino acids 4 to 184 (181 residues), 165.4 bits, see alignment E=2.5e-52 PF07722: Peptidase_C26" amino acids 71 to 170 (100 residues), 43.3 bits, see alignment E=7.9e-15 PF04715: Anth_synt_I_N" amino acids 234 to 373 (140 residues), 78.2 bits, see alignment E=1.7e-25 TIGR00553: aminodeoxychorismate synthase, component I" amino acids 330 to 677 (348 residues), 349.3 bits, see alignment E=2.1e-108 PF00425: Chorismate_bind" amino acids 422 to 675 (254 residues), 300 bits, see alignment E=3.2e-93

Best Hits

KEGG orthology group: K13950, para-aminobenzoate synthetase [EC: 2.6.1.85] (inferred from 100% identity to pfs:PFLU1771)

Predicted SEED Role

"4-amino-4-deoxychorismate synthase, amidotransferase component , aminase component (EC 2.6.1.-)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 2.6.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-, 2.6.1.85

Use Curated BLAST to search for 2.6.1.- or 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4Z9 at UniProt or InterPro

Protein Sequence (689 amino acids)

>PFLU_RS08710 aminodeoxychorismate synthase component I (Pseudomonas fluorescens SBW25-INTG)
MKILLIDNFDSFTQNIAQYLYEVTGICADIVTNTVTYEHLQIEQYDAVVLSPGPGHPGEY
LDFGVCGQVILHSPVPLLGICLGHQGIAQFLGGTVGHAPTPVHGYRSKITHSGSGLFRDL
PEQFEVVRYHSLMCTHLPQELRCTAWTEEGVVMAIEHESRPIWGVQFHPESIDSEYGHAL
LSNFIGMAIEHNGNHRTSATQNPDASASANEHYRAVGGLLNMQLAYRTYPGPFDPLALFT
QRYAQDHHAFWLDSEKSERPNARYSIMGSGQAQGSIRLTYDVNSESLTLAGPKGSRIVTG
DFFTLFSQIVESVNVAVPQYLPFEFKGGFVGYMGYELKALTGGNKVYRSGQPDAGFMFAP
HFFVFDHHDQTVYECMISATGQSPQWPQLLTSMTTLNNATDRRPFVPGAVDELELSLEDG
PDDYIRKVKQSLQYITDGESYEICLTNRARMSYSGEPLAAYRRMREASPVPYGAYLCFDS
FSVLSASPETFLRIDEGGLIESRPIKGTRARSKDPSEDQRLRSDLQASTKDRAENLMIVD
LVRHDLNQVCRSGSVHVPHIFAVESFSSVHQLVSTVRGHLRNDISTMEAIRACFPGGSMT
GAPKKRTMEIIDGLETCARGVYSGALGWISFSGSAELSIVIRTAVLHKQQAEFGIGGAIV
AHSDPNEELEETLVKASVPYYSFYAGSEK