Protein Info for PFLU_RS08665 in Pseudomonas fluorescens SBW25-INTG
Annotation: cytochrome c maturation protein CcmE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CCME_PSEFS: Cytochrome c-type biogenesis protein CcmE (ccmE) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K02197, cytochrome c-type biogenesis protein CcmE (inferred from 100% identity to pfs:PFLU1762)MetaCyc: 49% identical to periplasmic heme chaperone (Escherichia coli K-12 substr. MG1655)
RXN-21407
Predicted SEED Role
"Cytochrome c-type biogenesis protein CcmE, heme chaperone" in subsystem Biogenesis of c-type cytochromes
MetaCyc Pathways
- cytochrome c biogenesis (system I type) (7/11 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See C3K4Z0 at UniProt or InterPro
Protein Sequence (151 amino acids)
>PFLU_RS08665 cytochrome c maturation protein CcmE (Pseudomonas fluorescens SBW25-INTG) MNPLRRKRLLIILAILVGVGIAVGLALSALQQNINLFYTPTQIANGEAPIDTRIRAGGMV EKGSLKRSGDSLDVTFVVTDFNKAVTITYRGILPDLFREGQGIVALGKLNADGVVVADEV LAKHDEKYMPPEVTKALKDSGQSAPTPAKEG