Protein Info for PFLU_RS07695 in Pseudomonas fluorescens SBW25-INTG

Annotation: beta-N-acetylhexosaminidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00933: Glyco_hydro_3" amino acids 18 to 285 (268 residues), 273.9 bits, see alignment E=1e-85

Best Hits

Swiss-Prot: 84% identical to NAGZ_PSEA8: Beta-hexosaminidase (nagZ) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K01207, beta-N-acetylhexosaminidase [EC: 3.2.1.52] (inferred from 100% identity to pfs:PFLU1562)

MetaCyc: 84% identical to beta-N-acetylhexosaminidase (Pseudomonas aeruginosa PAO1)
Beta-N-acetylhexosaminidase. [EC: 3.2.1.52]

Predicted SEED Role

"Beta N-acetyl-glucosaminidase (EC 3.2.1.52)" (EC 3.2.1.52)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4V5 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PFLU_RS07695 beta-N-acetylhexosaminidase (Pseudomonas fluorescens SBW25-INTG)
MTAALQGSLMVDVAGTWLTAEDRHLLRQPEVGGLIIFARNIEHPRQVRELSAAIRAVRPD
LLLAVDQEGGRVQRLRQGFVRLPAMRALADNPNAEHLAEQCGWIMATEVLAVGLDLSFAP
VLDLDYQRSAVVGTRSFEGDPERAAVLAGAFIRGMNSAGMAATGKHFPGHGWAEADSHVA
IPNDERSLEQIRANDLVPFARLSKQLAAVMPAHVIYPQVDNQPAGFSRRWLQDILRGELQ
FDGVIFSDDLSMAGAHVVGDAASRIEAALTAGCDMGLVCNDRAAAELALTAAQRMKVKPS
ARIARMRGQAIASTDYKQDPRWLAAVTALREAQLIG