Protein Info for PFLU_RS07555 in Pseudomonas fluorescens SBW25-INTG

Annotation: LamB/YcsF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF03746: LamB_YcsF" amino acids 6 to 244 (239 residues), 313.7 bits, see alignment E=4.5e-98

Best Hits

Swiss-Prot: 88% identical to PXPA_PSEF5: 5-oxoprolinase subunit A (pxpA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K07160, UPF0271 protein (inferred from 100% identity to pfs:PFLU1534)

Predicted SEED Role

"Lactam utilization protein LamB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4V0 at UniProt or InterPro

Protein Sequence (246 amino acids)

>PFLU_RS07555 LamB/YcsF family protein (Pseudomonas fluorescens SBW25-INTG)
MSRLLLNCDIGESFGNWTMGLDAEVMPFIDCANVACGFHAGDPSIMRKTVSLALKHGVQV
GAHPAYQDLQGFGRRSMAYTPQEIQDLLHYQIGALDGICRAQGGCVSYVKPHGAMYNDMM
ANPAQLRAVIQAVAAYGELPLMLLATRDNSAAQALGDEYGVTLWFEAFADRAYDNKGHLV
SRQLPGAVHHDSDTIVQQALTISRGEALIASDGSPLVLQANTLCVHGDNASSVAAVQRIR
EALKPA