Protein Info for PFLU_RS07360 in Pseudomonas fluorescens SBW25-INTG

Annotation: 3-keto-5-aminohexanoate cleavage protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05853: BKACE" amino acids 6 to 302 (297 residues), 373.9 bits, see alignment E=2.5e-116

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1492)

MetaCyc: 98% identical to 2-deoxy-3-dehydro-D-ribonate cleavage enzyme (Pseudomonas simiae)
2.3.1.-

Predicted SEED Role

"hypothetical protein AF1210"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4S4 at UniProt or InterPro

Protein Sequence (310 amino acids)

>PFLU_RS07360 3-keto-5-aminohexanoate cleavage protein (Pseudomonas fluorescens SBW25-INTG)
MSKKRPVIITCAVTGAIHTPSMSPHLPITAQEIADAAIGAAEAGAAIVHLHARDPVDGRP
SQDPALFAEFLPHIKAASDVVINITTGGAPTMGVEERLQPVMQFKPELASLNMGSMNFGL
YEMLNRFTEFKHDWERPYLEESDDRIFRNTFRDITHILNSCAENRTRFEIECYDIGHLYT
AAHFLERGLLKPPLFIQSVFGLRGGIGGHPEDLAHMRRTADRLFGDDYVWSILGAGRGQI
PLATMGLSMGSNARVGLEDSLWDGPGKLAASNADQVRRIRTVIEALGHRVATPDEAREIL
GLKGRDQVNF