Protein Info for PFLU_RS06810 in Pseudomonas fluorescens SBW25-INTG

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00529: CusB_dom_1" amino acids 35 to 345 (311 residues), 50.8 bits, see alignment E=2.7e-17 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 359 (323 residues), 248.5 bits, see alignment E=4.1e-78 PF16576: HlyD_D23" amino acids 61 to 277 (217 residues), 53.3 bits, see alignment E=4.8e-18 PF13533: Biotin_lipoyl_2" amino acids 64 to 109 (46 residues), 28.4 bits, see alignment 2.3e-10 PF13437: HlyD_3" amino acids 159 to 274 (116 residues), 29.9 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 77% identical to MEPA_PSEPU: Multidrug/solvent efflux pump periplasmic linker protein MepA (mepA) from Pseudomonas putida

KEGG orthology group: K03585, membrane fusion protein (inferred from 100% identity to pfs:PFLU1380)

MetaCyc: 54% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBN4 at UniProt or InterPro

Protein Sequence (381 amino acids)

>PFLU_RS06810 efflux RND transporter periplasmic adaptor subunit (Pseudomonas fluorescens SBW25-INTG)
MQLKPAVTALVTAVALASLLSGCKKEEAAPPAQTPQVGVVTIQPQAFTLTSELPGRTTAY
RIAEVRPQVNGIILKRLFKEGADVKEGQQLYQIDPSVYEATLKSAQASLTQTKSISDRYK
QLVDEQAVSRQEYDTAVANRMTAEANVQTAQINVRYTKVFAPISGRIGRSSVTEGALVSN
GQADSMAVIQQLDPIYVDVTQSSAEMLKLRRDLESGQLEKAGANAAKVKLTLEDGSDYGQ
DGKLEFSEVSVDQTTGSVTLRAVFPNPDHTLLPGMFVHAQLQAGVNSKAILAPQQGVTRD
LKGTPTALIVNADNKVEQRELVANRTAGAYWLVEKGLNAGDRVITEGLQYVKPGAEVKVK
EADNAKPAGTAAPAAAAGKGE