Protein Info for PFLU_RS06800 in Pseudomonas fluorescens SBW25-INTG

Annotation: AdeC/AdeK/OprM family multidrug efflux complex outer membrane factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 10 to 464 (455 residues), 477.5 bits, see alignment E=2.2e-147 PF02321: OEP" amino acids 65 to 255 (191 residues), 85.7 bits, see alignment E=1.8e-28 amino acids 281 to 462 (182 residues), 110.5 bits, see alignment E=4.6e-36

Best Hits

Swiss-Prot: 78% identical to TTGC_PSEPK: Probable efflux pump outer membrane protein TtgC (ttgC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1378)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBN2 at UniProt or InterPro

Protein Sequence (485 amino acids)

>PFLU_RS06800 AdeC/AdeK/OprM family multidrug efflux complex outer membrane factor (Pseudomonas fluorescens SBW25-INTG)
MSKSLLSLAVTAFVLSGCSLIPDYQRPEAPVAAQFPQGPAYSSAQAPSQAAAEQGWKQFF
HDPALQQLIQTALVNNRDLRVAALNIDAYAAQYRIQRADLFPAVSANGSGSRQRVPARAS
QTGEANITSQYSATLGISSYELDLFGRVRSLSEEALQKYFATEEARRSTQISLVASVANA
YLTWQADKELLKLTQDTLGAFEQSFKLTSRSNEVGVASALDLSQARTSVENARVQLARYT
RQVAQDENSLTLLLGTGLPANIASKPLSDDLLSEVPAGLPSDLLQRRPDILQAEYNLKAA
NANIGAARAAFFPSISLTANAGTLSPDLGGLFKGGSGTWSFAPQINIPIFNAGSLRASLD
YSKIQKEINVANYEKAIQTGFQEVSDGLASRETYKQQLEAQRGFVAANQDYYRLAERRYR
IGVDSNLTFLDAQRQLFSAQQSLITDRLAQLTSEVNLYKALGGGWNEQTAKNEPLKEEAP
ALKLF