Protein Info for PFLU_RS06750 in Pseudomonas fluorescens SBW25-INTG

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 402 to 420 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 217 (197 residues), 98 bits, see alignment E=9.3e-32 amino acids 217 to 416 (200 residues), 44.5 bits, see alignment E=1.6e-15 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 26 to 415 (390 residues), 477 bits, see alignment E=2.6e-147 PF07690: MFS_1" amino acids 53 to 380 (328 residues), 103.6 bits, see alignment E=1.7e-33

Best Hits

Swiss-Prot: 71% identical to KGTP_SHIFL: Alpha-ketoglutarate permease (kgtP) from Shigella flexneri

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 100% identity to pfs:PFLU1368)

MetaCyc: 71% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"dicarboxylic acid transporter PcaT" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAN7 at UniProt or InterPro

Protein Sequence (431 amino acids)

>PFLU_RS06750 MFS transporter (Pseudomonas fluorescens SBW25-INTG)
MTTTTSHYTGEERSKRIFAIVGASSGNLVEWFDFYVYAFCAIYFAPAFFPSDDPTVQLLN
TAGVFAAGFLMRPIGGWLFGRVADKHGRKNSMMISVLMMCAGSLVIAFLPTYKDIGAWAP
ALLLVARLFQGLSVGGEYGTTATYMSEVALKGQRGFFASFQYVTLIGGQLLAVLVVVILQ
QILTEEELRAWGWRIPFVIGAIAAVISLLLRRTLKETTSKEMRQDKDAGSIAALFRNHKA
AFITVLGYTAGGSLIFYTFTTYMQKYLVNTAGMHAKTASYIMTGALFVYMCMQPLFGMLS
DKIGRRNSMLWFGALGTLCTVPILLTLKTVTSPFLAFVLISLALAIVSFYTSISGLVKAE
MFPPHVRALGVGLAYAVANAIFGGSAEYVALGLKSMGMENTFYWYVTGMMAVAFLFSLRL
PKQAEYLHHDL