Protein Info for PFLU_RS06740 in Pseudomonas fluorescens SBW25-INTG

Annotation: protocatechuate 3,4-dioxygenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF12391: PCDO_beta_N" amino acids 7 to 41 (35 residues), 38.6 bits, see alignment 6.9e-14 TIGR02422: protocatechuate 3,4-dioxygenase, beta subunit" amino acids 16 to 234 (219 residues), 360.9 bits, see alignment E=1.3e-112 PF00775: Dioxygenase_C" amino acids 45 to 226 (182 residues), 186.5 bits, see alignment E=3.2e-59

Best Hits

Swiss-Prot: 63% identical to PCXB_BURCE: Protocatechuate 3,4-dioxygenase beta chain (pcaH) from Burkholderia cepacia

KEGG orthology group: K00449, protocatechuate 3,4-dioxygenase, beta subunit [EC: 1.13.11.3] (inferred from 100% identity to pfs:PFLU1366)

MetaCyc: 57% identical to protocatechuate 3,4-dioxygenase type II beta subunit (Hydrogenophaga intermedia)
Protocatechuate 3,4-dioxygenase. [EC: 1.13.11.3]; 1.13.11.3 [EC: 1.13.11.3]

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAN5 at UniProt or InterPro

Protein Sequence (234 amino acids)

>PFLU_RS06740 protocatechuate 3,4-dioxygenase subunit beta (Pseudomonas fluorescens SBW25-INTG)
MSDKPGYRRPQAGTQPDYLHPAYQSTNLRSPSKPLVFLPHSLSEITGPTIGAERVDPKDN
DLTAQHEGEPQGERIIIHGRVLDENGLPVPGILVEIWQANAAGRYNHKRDLHDAPLDPNF
TGTGRTVTDAEGWYQFQTIKPGAYPWGNHHNAWRPAHIHFSLFGPSVLTRLVTQMYFPGD
PLLEYDPIYNCVPDTRAKERLIARFDLEKTIPSYALGYRWDIVLRGRDATPMEK