Protein Info for PFLU_RS05095 in Pseudomonas fluorescens SBW25-INTG

Annotation: maleylacetoacetate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 1 to 77 (77 residues), 53.3 bits, E=5.6e-18
• TIGR01262: maleylacetoacetate isomerase
  • amino acids 3 to 210 (208 residues), 270.3 bits, E=5.7e-85
• PF13417: GST_N_3
  • amino acids 3 to 82 (80 residues), 68.3 bits, E=1.2e-22
• PF13409: GST_N_2
  • amino acids 9 to 79 (71 residues), 63.5 bits, E=4.4e-21
• PF13410: GST_C_2
  • amino acids 139 to 186 (48 residues), 28.6 bits, 2.5e-10

Best Hits

Swiss-Prot: 75% identical to MAAI_PSEAE: Maleylacetoacetate isomerase (maiA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01800, maleylacetoacetate isomerase [EC: 5.2.1.2] (inferred from 100% identity to pfs:PFLU1027)

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)" (EC 2.5.1.18, EC 5.2.1.2)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450
• Styrene degradation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2

Sequence Analysis Tools

See C3K5D2 at UniProt or InterPro

Protein Sequence (211 amino acids)

>PFLU_RS05095 maleylacetoacetate isomerase (Pseudomonas fluorescens SBW25-INTG)
MELYTYYRSTASYRVRIALALKGLDFTAVPVNLLVPAGGANRQPEYLAINPQGRVPALRT
DEGELLIQSLAIIEYLEERYPQVPLLSNDLAARAHARAVASIIGCDIHPLHNSSTQNLLR
QWGHDEAKVLEWIGHWISQGLGAVEQLIGDQGYCFGDQPGLGDAFLIPQLYAAERFKVPL
AAYPRIGRVAALAAQHPAFVQAHPANQPDTP