Protein Info for PFLU_RS04950 in Pseudomonas fluorescens SBW25-INTG

Annotation: ATP-dependent RNA helicase RhlB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF00270: DEAD" amino acids 124 to 299 (176 residues), 158.9 bits, see alignment E=1.5e-50 PF04851: ResIII" amino acids 144 to 294 (151 residues), 33.3 bits, see alignment E=6.8e-12 PF00271: Helicase_C" amino acids 335 to 443 (109 residues), 102.4 bits, see alignment E=2.5e-33

Best Hits

Swiss-Prot: 95% identical to RHLB_PSESM: ATP-dependent RNA helicase RhlB (rhlB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03732, ATP-dependent RNA helicase RhlB [EC: 3.6.4.13] (inferred from 92% identity to pba:PSEBR_a4579)

Predicted SEED Role

"ATP-dependent RNA helicase RhlB" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KEA8 at UniProt or InterPro

Protein Sequence (489 amino acids)

>PFLU_RS04950 ATP-dependent RNA helicase RhlB (Pseudomonas fluorescens SBW25-INTG)
MTVLKALKKMFGKSEAEPLAPDSSAPTPTPGSRNDGQQPGRTAPVTPPKKPTVKPPEQAE
LVEAAPAPVAPKPRRERAPKPPVIPWKLEDFVVEPQEGKTRFHDFKLAPELMHAIQDLGF
PYCTPIQAQVLGFTLAGKDAIGRAQTGTGKTAAFLISIITQLLQTPPPKERYMGEPRALI
IAPTRELVVQIAKDAADLTKYTGLNVMTFVGGMDFDKQLKHLEARHCDILVATPGRLLDF
NQRGDVHLDMVEVMVLDEADRMLDMGFIPQVRQIIRQTPPKAERQTLLFSATFTEDVMNL
AKQWTTDPSIVEIEALNVASENVEQHIYAVAGADKYKLLYNLVNDNGWERVMVFANRKDE
VRRIEERLVRDGVNAAQLSGDVPQHKRIKTLEGFREGKIRVLVATDVAGRGIHIDGISHV
INFTLPEVPDDYVHRIGRTGRAGAAGVSISFAGEDDSYQLPSIETLLGRKISCETPPTHL
LRAVERKRP