Protein Info for PFLU_RS04205 in Pseudomonas fluorescens SBW25-INTG

Annotation: cytochrome c1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02167: Cytochrom_C1
  • amino acids 203 to 257 (55 residues), 24.3 bits, E=1.2e-09

Best Hits

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 100% identity to pfs:PFLU0843)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

See C3K6E5 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PFLU_RS04205 cytochrome c1 (Pseudomonas fluorescens SBW25-INTG)
MKKLFVALMLAALPLLSFAAEHGGPELEKVDIDVSDKAAMQDGARTFANYCMGCHSAKFQ
RYERVADDLGIPHEMMLEKLVFTGAKIGDHMNIGMKPADAKTWFGAAPPDLTLVARVRGT
DWLYGYLKSFYEDPARPYGVNNRVFPNVGMPNVLVGLQGKQVVGCKQIQVVEDGKKQYDP
LTGTPLTHEACDQLKIETPGSLTDEQFDEKVKNLVTFLAYSANPVKLQHQRIGTYVLLYL
AFFFVFAYLLKREYWKDVH