Protein Info for PFLU_RS03610 in Pseudomonas fluorescens SBW25-INTG

Annotation: redox-regulated ATPase YchF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00092: GTP-binding protein YchF" amino acids 1 to 366 (366 residues), 523.1 bits, see alignment E=2.1e-161 PF02421: FeoB_N" amino acids 5 to 46 (42 residues), 29.9 bits, see alignment 5.7e-11 PF01926: MMR_HSR1" amino acids 5 to 110 (106 residues), 73.8 bits, see alignment E=1.8e-24 PF06071: YchF-GTPase_C" amino acids 282 to 365 (84 residues), 138.3 bits, see alignment E=1.1e-44

Best Hits

KEGG orthology group: K06942, (no description) (inferred from 100% identity to pfs:PFLU0729)

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCR8 at UniProt or InterPro

Protein Sequence (366 amino acids)

>PFLU_RS03610 redox-regulated ATPase YchF (Pseudomonas fluorescens SBW25-INTG)
MGFNCGIVGLPNVGKSTLFNALTKSGIAAENFPFCTIEPNSGIVAMPDPRLQELAAIVNP
KRILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIAHVVRCFEDENVIHVSNSVD
PKRDIEIIDLELIFADLDSCEKQLQKVARNAKGGDKDAVVQKGLLEQLIAHFTLGKPARS
LMKSMNTDEKAVIKGFHLLTTKPVMYIANVAEDGFENNPLLDVVKAIADEEGAIVVPVCN
KIEAEIAELDDGEEKDMFLEALGLTEPGLNRVIRAGYEMLHLQTYFTAGVEEVRAWTVKV
GATAPQAAGVIHTDFEKGFIRAEVIAYNDFIQFKGEAGAKEAGKWRLEGKEYIVKDGDVM
HFRFNV