Protein Info for PFLU_RS03555 in Pseudomonas fluorescens SBW25-INTG

Annotation: EscS/YscS/HrcS family type III secretion system export apparatus protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 87 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details PF01313: Bac_export_3" amino acids 5 to 74 (70 residues), 76.3 bits, see alignment E=7.2e-26 TIGR01403: type III secretion protein, HrpO family" amino acids 6 to 81 (76 residues), 96.2 bits, see alignment E=4.8e-32

Best Hits

KEGG orthology group: K03227, type III secretion protein SctS (inferred from 100% identity to pfs:PFLU0716)

Predicted SEED Role

"Type III secretion inner membrane protein (YscS,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCQ5 at UniProt or InterPro

Protein Sequence (87 amino acids)

>PFLU_RS03555 EscS/YscS/HrcS family type III secretion system export apparatus protein (Pseudomonas fluorescens SBW25-INTG)
MEPIVLFKQGMLLVVVLSAPPLLVAVVVGVMTSLVQALMQVQDQTLPFGIKLVAVGITLI
MTGRWIGVELIQLINLTFDMIGRSALN