Protein Info for PFLU_RS03035 in Pseudomonas fluorescens SBW25-INTG

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 2 to 291 (290 residues), 347.3 bits, E=2.1e-107
• TIGR00406: ribosomal protein L11 methyltransferase
  • amino acids 3 to 285 (283 residues), 304.6 bits, E=3.7e-95
• PF05175: MTS
  • amino acids 142 to 227 (86 residues), 35.9 bits, E=1.4e-12
• PF13847: Methyltransf_31
  • amino acids 159 to 257 (99 residues), 30.9 bits, E=5.5e-11
• PF13649: Methyltransf_25
  • amino acids 161 to 250 (90 residues), 27.4 bits, E=1.1e-09

Best Hits

Swiss-Prot: 100% identical to PRMA_PSEFS: Ribosomal protein L11 methyltransferase (prmA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to pfs:PFLU0616)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See C3K6W5 at UniProt or InterPro

Protein Sequence (292 amino acids)

>PFLU_RS03035 50S ribosomal protein L11 methyltransferase (Pseudomonas fluorescens SBW25-INTG)
MPWLQVRLAISPEQAETYEDAFLEVGAVSVTFMDAEDQPIFEPELNTTPLWSHTHLLALF
EDGTDAAAVLAHMELLTGGPLPEHHSEVIEDQDWERSWMDNFQPMRFGQRLWIVPSWHAA
PEPDAVNLLLDPGLAFGTGTHPTTALCLEWLDGQDLTDSHVLDFGCGSGILAIAALLLGA
KEAVGTDIDVQALEASRDNAGRNNIPEGKFPLYLPEQLPQVQADVLVANILAGPLVSLAP
QLSSLVKPGGRLALSGILAEQGEDVAAAYAKDFELDPIANRDGWVRISGRRR