Protein Info for PFLU_RS02990 in Pseudomonas fluorescens SBW25-INTG

Annotation: precorrin-3B C(17)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF11760: CbiG_N" amino acids 48 to 126 (79 residues), 80.4 bits, see alignment E=8.2e-27 PF00590: TP_methylase" amino acids 292 to 503 (212 residues), 110 bits, see alignment E=1.6e-35 TIGR01466: precorrin-3B C17-methyltransferase" amino acids 293 to 539 (247 residues), 280.1 bits, see alignment E=7.5e-88

Best Hits

KEGG orthology group: K13541, cobalamin biosynthesis protein CbiG / precorrin-3B C17-methyltransferase [EC: 2.1.1.131] (inferred from 100% identity to pfs:PFLU0607)

Predicted SEED Role

"Cobalamin biosynthesis protein CbiG / Cobalt-precorrin-3b C17-methyltransferase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.131

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K6D5 at UniProt or InterPro

Protein Sequence (545 amino acids)

>PFLU_RS02990 precorrin-3B C(17)-methyltransferase (Pseudomonas fluorescens SBW25-INTG)
MSPAIVILGQGSLATARKIQQVYPGALIHGLAGRVEGADQTYSEFGATLRQLYQHGTPLI
ALCAAGIVIRTLAPLLLEKGEEPAVLAVAEDGSAVVPLLGGLGGVNVMARDIAAALDVAA
AITTSGELRFGTCLLNPPKGYELADLELGKRFVSDLLAGERVRIEGAAPWLDQANLPQDQ
QARLAIHVGSAERVPAANELLIYPKNVSVTCQPGAQLAQRVRTALHEAGIAVQSLACLLA
SDTQMAEASLHEAALELGVPLRFVSASQEADIVIDVAEQPLDLSRVGRLRGRLAVIGLGP
GAAELMVPAVKAELARCTDVLGYETYVRMAGPFRDDQVQHCTDNREEMQRARHAFELAAQ
GRSVVVVSSGDPGVFAMAAAVIEALHASSDPAWHQVDLQILPGVSASLATAAQAGAPLGH
DFCVMSLSDNLKPWSIIEKRLDLASQADLALAFYNPISRSRPWQLGRALEIVALHRTPQT
PVVLGRDIGRPGQTLRVTTLGQLTPEQVDMRTMVLIGSSTTCTFPRAGGGEWVYTPRWYG
EKPAS