Protein Info for PFLU_RS02870 in Pseudomonas fluorescens SBW25-INTG

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13420: Acetyltransf_4
  • amino acids 2 to 154 (153 residues), 47.4 bits, E=6.8e-16
• PF13302: Acetyltransf_3
  • amino acids 2 to 135 (134 residues), 49.8 bits, E=1.8e-16
• PF00583: Acetyltransf_1
  • amino acids 14 to 135 (122 residues), 66.2 bits, E=9.6e-22
• PF13673: Acetyltransf_10
  • amino acids 46 to 141 (96 residues), 32.9 bits, E=1.8e-11
• PF13508: Acetyltransf_7
  • amino acids 52 to 136 (85 residues), 33.1 bits, E=1.8e-11
• PF08445: FR47
  • amino acids 83 to 138 (56 residues), 34.1 bits, E=6.8e-12

Best Hits

Swiss-Prot: 74% identical to MDDA_PSEA7: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (PSPA7_5587) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to pfs:PFLU0581)

MetaCyc: 66% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• phosalacine biosynthesis (4/25 steps found)
• phosphinothricin tripeptide biosynthesis (4/25 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

See C3K5A4 at UniProt or InterPro

Protein Sequence (170 amino acids)

>PFLU_RS02870 N-acetyltransferase (Pseudomonas fluorescens SBW25-INTG)
MIRDATQNDLPAIRDIYNDAVLNTTAIWNEQPVDLGNRQAWFSARHAQGYPILVSVENAE
VTGYASFGDWRPFEGFRYSVEHSVYVRNDQRGKGLGPLLMQALIERARTCGKHVMVAAIE
SGNQASIRLHERQGFITTGQMPRVGIKFGRWLDLTFMQLALNPGAEPPKE