Protein Info for PFLU_RS02700 in Pseudomonas fluorescens SBW25-INTG

Annotation: ammonia-dependent NAD(+) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF02540: NAD_synthase" amino acids 28 to 272 (245 residues), 212.2 bits, see alignment E=3.2e-67 TIGR00552: NAD+ synthetase" amino acids 30 to 272 (243 residues), 217 bits, see alignment E=1.2e-68

Best Hits

Swiss-Prot: 89% identical to NADE_PSEPF: NH(3)-dependent NAD(+) synthetase (nadE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 100% identity to pfs:PFLU0546)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.5

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KE79 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PFLU_RS02700 ammonia-dependent NAD(+) synthetase (Pseudomonas fluorescens SBW25-INTG)
MQAVQREIAEQLKVQAPFNDQAALEAEVARRVTFIQDCLRNSGLKTLVLGISGGVDSLTA
GLLAQRAMQELRASTGDEAYRFIAVRLPYETQFDELDAQASVDFIEPDERHTVNIGPAVK
ALANEVAAFEGKAAVSRDFVLGNTKARMRMVAQYTIAGAAGGLVIGTDHAAEAVMGFFTK
FGDGACDLAPLSGLVKNQVRAIARHFGAPESLVEKVPTADLEDLSPGKPDEASHGVTYAE
IDAFLHGEPVREEAFKIICETYRKTEHKRVMPFAP