Protein Info for PFLU_RS02580 in Pseudomonas fluorescens SBW25-INTG

Annotation: FtsH protease activity modulator HflK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 67 to 89 (23 residues), see Phobius details PF12221: HflK_N" amino acids 1 to 50 (50 residues), 67 bits, see alignment 1.1e-22 TIGR01933: HflK protein" amino acids 86 to 348 (263 residues), 377.3 bits, see alignment E=2e-117 PF01145: Band_7" amino acids 88 to 260 (173 residues), 100.5 bits, see alignment E=1.2e-32

Best Hits

Swiss-Prot: 44% identical to HFLK_VIBPA: Protein HflK (hflK) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 100% identity to pfs:PFLU0522)

MetaCyc: 42% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDW5 at UniProt or InterPro

Protein Sequence (391 amino acids)

>PFLU_RS02580 FtsH protease activity modulator HflK (Pseudomonas fluorescens SBW25-INTG)
MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNGLFGGGKKRGGDEGGR
TSKGGGYGLLGLGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYYETVGPGLNIYFPPIDK
KYMENVTRERAYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATESA
LRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAF
DDVIRAREDEQRSRNQAETYANGVVPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKL
VAEYRKAPEVTRERLYLDTMQEVFSNTSKVLVTGSKGGQNNLLYLPLDKMIEGGRSSTSA
PSTGSNAAANEASARAAADLLQQQTRTRESR